Gold Member Since 2016
Audited Supplier
Shanghai Stero R&D Co., Ltd.

Cjc1295 Powder, Cjc1295 Dac, Cjc1295 manufacturer / supplier in China, offering Factory Direct Supply Cjc1295 with or Without Dac Peptide Powder, Oral Anabolic Steroids Anavar Pills Anavar, Fat Burning Dianabol for Muscle Mass Steroids and so on.

(/ )

Supplier Homepage Product POLYPEPTIDES PHARMACEUTICAL POLYPEPTIDES Factory Direct Supply Cjc1295 with or Without Dac Peptide Powder

Factory Direct Supply Cjc1295 with or Without Dac Peptide Powder

FOB Price: US $0.3-2.5 / Grams
Min. Order: 10 Grams
Min. Order FOB Price
10 Grams US $0.3-2.5/ Grams
Get Latest Price
Port: Hong Kong, Hong Kong
Production Capacity: 10000vials /Month
Payment Terms: L/C, T/T, D/P, Western Union, Paypal, Money Gram, Bitcoin
Basic Info
  • Model NO.: 863288-34-0
  • Customized: Customized
  • Suitable for: Adult
  • Purity: 99.7%
  • Cjc1295 Forms: 2mg/Vial
  • Customs Pass: Guaranteed
  • Shelf Life: 2 Years
  • Quality: Top Standard
  • Realated Products: Cjc1293, Cjc 1295 Dac
  • Transport Package: Unique Discreet Ways of Packing for Pass Customs
  • Origin: China
  • Powder: Yes
  • Certification: GMP, HSE, ISO 9001, USP, BP, SGS
  • State: Solid
  • Cjc1295: Peptides Products
  • Cjc1295 Functions: Bodybuilding, Weight Loss
  • Price: Negotiation
  • About Us: Factory Manufacturer
  • Delivery Time: 3-5 Working Days
  • Trademark: ShangHai steroid
  • Specification: USP, BP, SGS
  • HS Code: 4601220000
Product Description
Introduction
GHRH's are paired specifically with GHRP's in order to create a synergy between the peptides that will unlock the body's own stores of growth hormone.  Even though many peptides work in some capacity by themselves, it is most beneficial to run your GHRH alongside a GHRP.  This is why CJC 1295 is highly desirable, and it's one of the most widely used in the bodybuilding community.  Right now, it has been debated which CJC 1295 is best to use.  While MOD GRF (CJC 1295 no DAC) is commonly used with GHRP's to increase pituitary GH pulse, more frequent injections will need to be administered.  The CJC 1295 with DAC will result in a series of smaller pulses; therefore, injections will be less frequent - often two to three times a week.

DAC or no DAC?
As I have just stated above, when a person sees the term CJC 1295 without DAC this is really means that they are looking at MOD GRF 1-29.  This tetrasubstitued peptide is a modified version of the original GRF 1-29 peptide better known as Semorelin.  Due to the extreme short half life of the original GRF 1-29, chemists were able to modify the peptide to offer a longer biological activity that reduced the metabolic clearance.   Although with MOD GRF 1-29 its modification had resulted in a greater peptide bond, the average user will still likely need to inject two to three times a day with a GHRP to get the maximum effectiveness for releasing endogenous growth hormone.  Now when the drug affinity complex (DAC) was added to CJC 1295, it allowed for an even greater possibility to utilize smaller GH pulses (what was once thought of as a bleed) that, when combined with a GHRP, will activate growth hormone stores to release throughout the day and night.  When the DAC component was added, this allowed the peptide half-life to be extended to about one week and also provided for steadier blood levels after injection.   Now that we understand how important the DAC factor is, this becomes a much more viable and cost effective way to utilize CJC 1295 with DAC along with a GHRP.  The DAC, when added, is able to bind to albumin that circulates the body, literally being able to last for days as it looks for receptors to bind to.  So, in short, if you prefer to use shorter spikes of GH release then the use of the MOD GRF 1-29 (CJC 1295 without DAC) is going to be optimal.  However, if your prefer fewer injections and still want to unleash your growth hormone stores, then 2-3 times a week injections of CJC 1295 with DAC along with your daily injection of GHRP would be the way to proceed for maximizing growth hormone release.

Dosage and Usage
The naming might have thrown you for a loop, but don't let that stop you from understanding the reason why you should utilize one of the best GHRH's out there.  CJC 1295 is probably the best and most widely use GHRH along with your chosen GHRP.  Like all of the other peptides you are dealing with, it is a delicate lyophilized powder that should be kept out of the light and in a cool dry place.  Reconstitution is done with bacteriostatic water or sodium chloride meant for injection.  As already stated before, to mimic the natural release of growth hormone through the natural spikes you would achieve through the day MOD GRF 1-29 (CJC 1295 without DAC) should be injected 1-3 times per day at 100mcg-200mcg doses along with your GHRP of choice.  Now, the most cost effective and in my opinion better way to utilize CJC 1295 is to go with the CJC 1295 with DAC.  This will allow the bodybuilder or athlete to inject 2mg of CJC 1295 with DAC twice weekly along with their daily injection of GHRP.  This will offer smaller but more frequent growth hormone pulses that would ideally get a user closer to exogenous HGH doses.
 
SequenceH-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2
Molecular FormulaC152H252N44O42
One Letter SequenceY(d-A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2
Physical Apperancewhite powder
Form & FormulationsSterile Filtered white lyophilized (freeze-dried)
Stability2 months at room temperature 24 months from date of receipt, ­20 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, ­20 to ­70 °C under sterile conditions after reconstitution.
Suitabilitysuitable for cell culture and animal experiment
Purity>98% by RP-HPLC
StorageStore at -20°C. Product is guaranteed 2 years from the date of shipment. Following reconstitution, store at -20°C. We recommend to add a carrier protein (0.1% HSA or BSA) for long term storage.
 

CJC 1295 without DAC, Mod GRF 1-29, modified GRF 1-29 or simply CJC 1295 is a peptide that consists of thirty amino acids in its chain. It is an essential peptide that accentuates the release of growth hormone and insulin growth factor 1. The modified version has a drug affinity complex or DAC. The drug affinity complex is essential because it enhances the binding affinity of the peptide to the ligand and prevents degradation of the peptide by foreign enzymes and other degradation compounds. The synthetic peptide has a half-life of about thirty minutes. Since it has a very short half-life, researchers are looking for avenues to use different modes of administration to maximize its activity and give the desired impact. Since its discovery, CJC 1295 has undergone various modifications that alter its structure and enhance its activity by increasing its stability. This was done by adding four amino acids to the structure. The part which stimulates the secretion of growth hormone from the anterior lobe of the pituitary gland is found in the first 1-29 amino acids so hence the name GRF 1-29.
The synthetic peptide has a half-life of about thirty minutes. Since it has a very short half-life, researchers are looking for avenues to use different modes of administration to maximize its activity and give the desired impact. Since its discovery, CJC 1295 has undergone various modifications that alter its structure and enhance its activity by increasing its stability. This was done by adding four amino acids to the structure. The part which stimulates the secretion of growth hormone from the anterior lobe of the pituitary gland is found in the first 1-29 amino acids so hence the name GRF 1-29.


 
Send your message to this supplier
Avatar
Miss Sara WhatsApp: +86 17068712527
*From:
To: Miss Sara WhatsApp: +86 17068712527
*Message:

Enter between 20 to 4,000 characters.

This is not what you are looking for? Post a Sourcing Request Now

Find Similar Products By Category